PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_F6827247E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 85aa    MW: 9560.81 Da    PI: 9.0255
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_F6827247E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.38.9e-214573487
                           SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                     B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                           + l +ed +g++W+++++y+++s +yvltkGW++Fv+++gL +gD+vvF+ ++ 
  Traes_4BL_F6827247E.1  4 VLLNFEDGEGKVWRFRYSYWNSSLSYVLTKGWSRFVREKGLVAGDVVVFSCSEY 57
                           56899********************************************96654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.324171IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-22269IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.83E-18466IPR015300DNA-binding pseudobarrel domain
PfamPF023623.5E-18457IPR003340B3 DNA binding domain
CDDcd100174.20E-16852No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
DKAVLLNFED GEGKVWRFRY SYWNSSLSYV LTKGWSRFVR EKGLVAGDVV VFSCSEYGQE  60
KHFFIDYKKT TTVSGGAAAS PPPVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A4e-2727150118DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703069e-59HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968155.12e-33PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0141000-like
SwissprotQ0DXB12e-34Y2641_ORYSJ; B3 domain-containing protein Os02g0764100
SwissprotQ9AWS04e-33Y1410_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0141000
TrEMBLW5E8F13e-57W5E8F1_WHEAT; Uncharacterized protein
STRINGMLOC_56567.15e-40(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151591316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.28e-28related to ABI3/VP1 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]